Skip to content

Repository files navigation

SecretoGen

A conditional autoregressive model of signal peptides. SecretoGen generates signal peptides conditional on the mature protein sequence and the host organism.

Resources

The trained model weights are available at https://erda.ku.dk/archives/1a91453689c691c242f78268ff2fe1aa/published-archive.html. You don't have to download this manually, the scripts will automatically fetch the checkpoint.

Overview

The SecretoGen model architecture is defined in src/pretraining/models/seq2seq.py. The taxonomy vocabulary is stored in data/taxonomy_mappings. We use this for mapping a species to its set of taxonomy tokens using src.utils.alphabets.TaxonomyMapping.

Computing perplexities

SecretoGen requires torch, pandas and tqdm. You can install them with pip install -r requirements.txt.

The script compute_perplexity.py can score SecretoGen perplexities from csv-formatted input data. If --checkpoint is not specified, the script will automatically download the model weights and store them in checkpoints/secretogen.pt.

python3 compute_perplexity.py  --data data/efficiency_data/wu.csv --out_file test_run.csv

Note that as of torch version 2.2, a warning "enable_nested_tensor is True" will be printed. This flag was not available in the torch version used to train the model, and it should be safe to ignore the warning.

Generating signal peptides

The script generate_sequences.py can generate signal peptides using top-p sampling for a given mature protein sequence and host organism.

This example generates 1000 SPs for a Xylanase in Bacillus subtilis (1423).

python3 generate_sequences.py test_samples.csv --org_id 1423 --seq "GSRTITNNEMGNHSGYDYELWKDYGNTSMTLNNGGAFSAGWNNIGNALFRKGKKFDSTRTHHQLGNISINYNASFNPGGNSYLCVYGWTQSPLAEYYIVDSWGTYRPTGAYKGSFYADGGTYDIYETTRVNQPSIIGIATFKQYWSVRQTKRTSGTVSVSAHFRKWESLGMPIGKMYETAFTVEGYQSSGSANVMTNQLFIGN" --top_p 0.75

Benchmark data

SecretoGen was evaluated on a set of studies that experimentally evaluated the secretion efficiency of signal peptides. If you reuse the data, please cite the respective original works.

Grasso et al.

@article{doi:10.1021/acssynbio.2c00328,
author = {Grasso, Stefano and Dabene, Valentina and Hendriks, Margriet M. W. B. and Zwartjens, Priscilla and Pellaux, René and Held, Martin and Panke, Sven and van Dijl, Jan Maarten and Meyer, Andreas and van Rij, Tjeerd},
title = {Signal Peptide Efficiency: From High-Throughput Data to Prediction and Explanation},
journal = {ACS Synthetic Biology},
volume = {12},
number = {2},
pages = {390-404},
year = {2023},
doi = {10.1021/acssynbio.2c00328},
note ={PMID: 36649479},
URL = {https://doi.org/10.1021/acssynbio.2c00328},
eprint = { https://doi.org/10.1021/acssynbio.2c00328}
}

Wu et al.

@article{doi:10.1021/acssynbio.0c00219,
author = {Wu, Zachary and Yang, Kevin K. and Liszka, Michael J. and Lee, Alycia and Batzilla, Alina and Wernick, David and Weiner, David P. and Arnold, Frances H.},
title = {Signal Peptides Generated by Attention-Based Neural Networks},
journal = {ACS Synthetic Biology},
volume = {9},
number = {8},
pages = {2154-2161},
year = {2020},
doi = {10.1021/acssynbio.0c00219},
note ={PMID: 32649182},
URL = {https://doi.org/10.1021/acssynbio.0c00219},
eprint = {https://doi.org/10.1021/acssynbio.0c00219}
}

Xue et al.

@article{https://doi.org/10.1002/advs.202203433,
author = {Xue, Songlyu and Liu, Xiufang and Pan, Yuyang and Xiao, Chufan and Feng, Yunzi and Zheng, Lin and Zhao, Mouming and Huang, Mingtao},
title = {Comprehensive Analysis of Signal Peptides in Saccharomyces cerevisiae Reveals Features for Efficient Secretion},
journal = {Advanced Science},
volume = {10},
number = {2},
pages = {2203433},
doi = {https://doi.org/10.1002/advs.202203433},
url = {https://onlinelibrary.wiley.com/doi/abs/10.1002/advs.202203433},
eprint = {https://onlinelibrary.wiley.com/doi/pdf/10.1002/advs.202203433},
year = {2023}
}

Zhang et al.

@article{zhang_optimal_2016,
title = {Optimal secretion of alkali-tolerant xylanase in {Bacillus} subtilis by signal peptide screening},
volume = {100},
issn = {1432-0614},
url = {https://doi.org/10.1007/s00253-016-7615-4},
doi = {10.1007/s00253-016-7615-4},
language = {en},
number = {20},
urldate = {2022-11-22},
journal = {Applied Microbiology and Biotechnology},
author = {Zhang, Weiwei and Yang, Mingming and Yang, Yuedong and Zhan, Jian and Zhou, Yaoqi and Zhao, Xin},
month = oct,
year = {2016},
pages = {8745--8756},
}

Baseline methods

compute_perplexity_progen.py and compute_perplexity_spgen.py work on the same input format. For SPGen, you will have to edit the checkpoint paths on lines 23 to 26. Checkpoints were prepared by extracting the state dicts from the checkpoints in the original SPGen repository, so that loading the checkpoint files does no longer depend on the SPGen directory structure for dependencies.

About

A conditional generative model for signal peptide design and efficiency prediction

Topics

Resources

Stars

12 stars

Watchers

1 watching

Forks

Releases

Packages

Used by

Contributors

Languages