Skip to content

Repository files navigation

OCDesign: Objective curriculum-guided design of multi-property proteins

OCDesign method overview

Overview

OCDesign is an objective curriculum-guided computational framework for multi-property protein design. Instead of optimizing all properties simultaneously, OCDesign introduces design objectives sequentially according to a predefined objective curriculum. In each stage, candidate sequences are generated, evaluated across relevant properties, selected using Pareto-front analysis, and then prioritized for experimental validation.

This repository contains code, example data, designed sequences, property evaluation results, and figure-related files used in our study:

Objective curriculum-guided design of multi-property proteins

Stage Objective(s) Purpose
Stage 1 Solubility and structural consistency Establish foldable and expressible designs
Stage 2 Binding affinity Introduce antibody-binding function
Stage 3 Alkaline resistance Improve robustness under alkaline conditions

This objective order was predefined based on domain knowledge to progressively introduce increasingly specific functional requirements.

OCDesign workflow

OCDesign consists of four main steps:

  1. Protein sequence generation Generate candidate protein sequences using NeuralMRF, ProDESIGN-LE, or other sequence design models. Property assessment
  2. Evaluate designed proteins using computational property predictors or scoring functions, such as solubility, structural consistency, energy, binding-related scores, or task-specific properties.
  3. Pareto-front selection Select candidate designs based on Pareto-optimal trade-offs among multiple properties.
  4. Wet-lab validation and curriculum update Experimentally validate selected candidates and use the results to guide subsequent design decisions and introduce the next objective in the curriculum.

Installation

We recommend using conda to create the required environment.

conda env create -f environment.yaml
conda activate neuralmrf

You need install PyTorch (the CUDA 11.1 version) manually

pip install torch==1.10.1+cu111 torchvision==0.11.2+cu111 torchaudio==0.10.1 -f https://download.pytorch.org/whl/cu111/torch_stable.html

However, you may meet the error like following for torch, and we provide the way to fix this error

from torch._C import *  # noqa: F403
ImportError: libtorch_cpu.so: cannot enable executable stack as shared object requires: Invalid argument  

find YOUR_ENV_PATH -name libtorch_cpu.so
patchelf --clear-execstack YOUR_ENV_PATH/python3.8/site-packages/torch/lib/libtorch_cpu.so

NeuralMRF: sequence design for a given protein structure

NeuralMRF designs protein sequences conditioned on an input protein structure.

Input

Protein structure file in .pdb format Optional fixed-residue file specifying residues that should remain unchanged during design

Key parameters

--seed             Random seed for sequence generation
--checkpoint_path  Path to the trained NeuralMRF model checkpoint
--device           GPU device ID
--pdb_path         Path to the input PDB file
--chain            Chain ID used for sequence design
--fix_file         File specifying fixed residues
--output_file      Output FASTA file; optional

Example: sequence design for each objective stage

Stage 1: solubility and structural consistency

python run_neuralmrf.py \
  --seed 37 \
  --chain A \
  --fix_file example/fix_file/round1.txt \
  --pdb_path example/pdb/5u4y.pdb \
  --device 1

Example output:

>5u4y Identity:0.4339622641509434
SDNALQNAMKEIQHLPNLDEAEKNSFLLALVLDPSAAEVLRAEARQINIDRQP

Stage 2: binding affinity

python run_neuralmrf.py \
  --seed 37 \
  --chain A \
  --fix_file example/fix_file/round2.txt \
  --pdb_path example/pdb/5u4y.pdb \
  --device 1

Example output:

>5u4y Identity:0.660377358490566
FNKAQQNAFYEILHLPNLDEAQKNSFILRLKLDPSAAEVLRAEARQINIDQAP

Stage 3: alkaline resistance

python run_neuralmrf.py \
  --seed 37 \
  --chain A \
  --fix_file example/fix_file/round3.txt \
  --pdb_path example/pdb/5u4y.pdb \
  --device 1

Example output:

>5u4y Identity:0.660377358490566
FAKAQQNAFYEILHLPNLTEEQKNWFILRLKLDPSVAEVLRAEARQINIDQAP

Pareto-front selection

Candidate designs can be selected based on Pareto-optimal trade-offs among multiple properties.

Usage

python pareto_frontier.py CSVFILE --sort 'Property1:min,Property2:max'

Example

python pareto_frontier.py example/pareto/r2_pareto.csv \
  --sort 'RMSD_VAR:min,MMGBS:min,Solubility:max'

In this example:

  • RMSD_VAR:min selects designs with lower structural variation.
  • MMGBS:min selects designs with more favorable binding energy.
  • Solubility:max selects designs with higher predicted solubility.

The script outputs candidate designs on the Pareto front according to the specified property directions.

Reproducing paper results

The repository provides example files for reproducing the main computational steps:

  • Generate sequences using NeuralMRF.
  • Assess designed sequences using property scores provided in data/property_scores/.
  • Perform Pareto-front selection using pareto_frontier.py.
  • Compare selected designs with experimentally validated candidates.
  • Reproduce figure panels using files in results/figures/.

Citation

If you use OCDesign or the data in this repository, please cite the manuscript under review.

@article {Liu2026.05.25.727596,
        author = {Liu, Longying and Zhao, Jianquan and Xie, Xiaomin and Xu, Simeng and Ren, Milong and Zhang, Xinru and He, Zaikai and Liu, Fan and Yu, Chungong and Wang, Kun and Wang, Xinglong and Liang, Xinmiao and Ye, Xianlong and Bu, Dongbo and Zhou, Han},
        title = {Objective curriculum-guided design of multi-property proteins},
        elocation-id = {2026.05.25.727596},
        year = {2026},
        doi = {10.64898/2026.05.25.727596},
        publisher = {Cold Spring Harbor Laboratory},
        abstract = {Designing functional proteins that simultaneously possess multiple biochemical properties remains a significant challenge, as key protein properties, such as solubility, stability, binding affinity, and chemical resistance, are often interdependent or even conflicting. Current approaches typically attempt to jointly optimize multiple functional objectives in one shot, followed by extensive screening to identify rare feasible designs. Here, we introduce OCDesign, an objective curriculum-guided framework for multi-property protein design. OCDesign is based on the objective curriculum principle, which states that the order in which objectives are introduced can shape the accessibility of functional solutions. In each design round of OCDesign, candidate sequences are generated in silico, assessed across multiple properties, selected based on Pareto-optimal trade-offs, and experimentally validated, with each experimental stage testing the role of the newly introduced objective within the curriculum. Using antibody-binding protein A as a model system, we show that one-shot optimization fails to yield functional designs, whereas a staged curriculum{\textemdash}progressing from solubility and structural consistency to binding affinity, and then to alkaline resistance{\textemdash}enables the design of proteins possessing multiple desired properties through substantially fewer wet-lab experiments. These results establish OCDesign as a practical computational{\textendash}experimental strategy for organizing and integrating multiple objectives in protein design, and suggest that objective ordering is a key determinant of accessibility in high-dimensional design spaces.Competing Interest StatementThe authors have declared no competing interest.the National Key Research and Development Program of China, 2024YFC3405501the National Natural Science Foundation of China, 32271297the Jiangxi Provincial Key Research and Development Program, 2025BAC250061the Special Fund for Digital Economy on Budgetary Infrastructure Investment of Jiangxi Province, 2506-360000-04-04-511042},
        URL = {https://www.biorxiv.org/content/early/2026/05/29/2026.05.25.727596},
        eprint = {https://www.biorxiv.org/content/early/2026/05/29/2026.05.25.727596.full.pdf},
        journal = {bioRxiv}
}

The citation will be updated after publication.

Contributors

  • Longying Liu., Jianquan Zhao, and Xiaomin Xie contributed equally.
  • Xinmiao Liang, Xianlong Ye, Dongbo Bu., and Han Zhou. conceptualized the study.
  • Longying Liu. performed wet lab experiments, data curation, and wrote the original draft.
  • Jianquan Zhao. performed multi-round molecular design.
  • Xiaomin Xie performed molecular simulation design and MD simulation-based screening.
  • Simeng Xu. assisted with wet lab experiments.
  • Xinru Zhang. performed primary protein sequence design using ProDESIGN-LE.
  • Zaikai He. revised the manuscript.
  • Chungong Yu. provided top-level design and guidance.
  • Fan Liu. assisted with molecular simulation.
  • Kun Wang. contributed to protein sequence design using ProDESIGN-LE.
  • Xinglong Wang. contributed to NeuralMRF development.
  • Milong Ren. revised the manuscript.
  • Xinmiao Liang. provided top-level design and guidance.
  • Xianlong Ye. supervised the study, provided overall conceptualization and guidance.
  • Dongbo Bu. supervised the study, provided overall conceptualization and guidance, and revised the manuscript.
  • Han Zhou. supervised the study, provided overall conceptualization and guidance, and revised the manuscript.

License

  • Code: MIT License or Apache License 2.0
  • Data and figures: CC BY 4.0,

Contact

For questions, please contact:

Dongbo Bu (Corresponding author): dbu@ict.ac.cn
Jianquan Zhao (Co-first author): zhaojianquan@ict.ac.cn

About

Objective curriculum-guided design of multi-property proteins

Resources

Stars

Watchers

Forks

Releases

Packages

Contributors

Languages