Without a set of common genes shared between all viruses, it becomes difficult to deduce phylogeny of viruses. Other method of gene-sharing maps exist to combat this problem and are preferred. However, if you would like a classic tree, you can use this instead. This method uses a series of custom genes that the user selects to base a phylogenetic tree on.
- HMMER installed
conda install -c bioconda hmmer - MUSCLE installed
conda install -c bioconda muscle - trimal installed
conda install -c bioconda trimal - raxml-ng installed if you want to make a phylogenetic tree with it
conda install -c bioconda raxml-ng
- all_gene_calls.faa --> file of all my phage genomes gene calls as amimo acids
- I like to genecall them with glimmer3 and use prodigal to convert the nuclotides to amino acids
- All the genecalls smooshed into one file per virus. You can do this with this script.
for i in *_reformatted.faa; do
awk '/^>/ {if (c++ == 0) {print;}next}/^$/ {next}{printf "%s", $0}END {print ""}' Aegir_VP1_reformatted.faa | sed 's/\*//g' > $(basename $i .faa)_concat.faa;
done
cat *concat.faa > SAR11_phages.faa
long-orfs -n -t 1.15 REPLACE_ME run3.longorfs
extract -t REPLACE_ME run3.longorfs > run3.train
build-icm -r run3.icm < run3.train
glimmer3 -o50 -g110 -t30 REPLACE_ME run3.icm run3.run1
tail -n +2 run3.run1.predict > run3.coords
upstream-coords.awk 25 0 run3.coords | extract REPLACE_ME - > run3.upstream
elph run3.upstream LEN=6 | get-motif-counts.awk > run3.motif
startuse="$(start-codon-distrib -3 REPLACE_ME run3.coords)"
glimmer3 -o50 -g110 -t30 -b run3.motif -P $startuse REPLACE_ME run3.icm FINAL
extract -t REPLACE_ME FINAL.predict > $(basename REPLACE_ME .fasta)_Glimmer.fnn
anvi-script-reformat-fasta -o $(basename REPLACE_ME .fasta)_rfmt.fna --simplify-names --prefix $(basename REPLACE_ME .fasta) $(basename REPLACE_ME .fasta)_Glimmer.fnn
prodigal -i $(basename REPLACE_ME .fasta)_rfmt.fna -a $(basename REPLACE_ME .fasta)_Glimmer.faa -q -p meta
rm run3* FINAL*
This should result in a file that looks like this
cat all_SAR11_phages.faa
>Aegir_VP1_000000000001_1 # 1 # 2286 # 1 # ID=1_1;partial=11;start_type=Edge;rbs_motif=None;rbs_spacer=None;gc_cont=0.287
MLTETLSKLETLGPVGIKIRSIMNERYDFLNKESNGPLKSGIVRMIDKHKIDYNMMIQLSYSIVATGTTEGQNLIQLAIAIGNRIRNYYKLPTKAELDLRLGVFVLNAYALNNMLIIKLVNDFKSFNKAKTVYKVYMGYNRSDMRKLMKEFNEVHDPFKPLFTKAPEWEFGTVLNPNGESIKLIKQSKIDTIARINKHNTPIVLNATNKKQAVAFYVNPEVYEIYKWALQTNQHCFEHNSVDTIAKERKEAKKAEALQVLKATELYVGKKFYQQYTCDSRGRFYPLSAYLNELNSDNAKGMLSFFEGKPLGNNGKAQLFHHIANMWGEDKLSHADRVKFVEDNYYEFVTYGSKPKDARGWMQAAEPIQFLSAVIELAKLDKHFVANGTVEDFISHTICYRDGSNNGLQWLFSLVKDNKNGHLVNIKPTTDNKPGDMYNHVAVSVKDIMHNKAKEEDNLSLDYYNLYFKSIEKIRNRWRIAELNNDKNVENKKRLIKWYQKRYRTELKLTDIIYWDKAKFTIKEWRKIVKRNVMTYGYSATKQGMGEQIIQDTRDIDNVYLSNKQHSAARALGSLVYTTIETEFPEVAAAMKLFKDNCAAYMKKHNKQYSHNTLISNFPFTQHYVKYKSARVKLTDGLYIMNNDKSFKWVNRVDFVIKTELPILNIGKAKAAISPNSIHNLDSLHLMLVIDECDFDIVSAHDSYGAHACNVNMMQKVIRSQFKRIIDANPLQHNLNETGNLVPMIKQGQLDSSEILKSEFAFA
>Aegir_VP1_000000000002_1 # 1 # 144 # 1 # ID=2_1;partial=11;start_type=Edge;rbs_motif=None;rbs_spacer=None;gc_cont=0.222
MFDKYVYPILEKIGEGIEKIYWFCSNNKQEVTWFSFGFIVCALINLII
-
Gene called your organisms and BLAST them against a database to get an annotated gene function for each. Then select genes that are specific to your taxa of interest and find them within your annotations. For example, for a viral phlogenetics I chose capsid, DNA polymerase, exonuclease, endonuclease, helicase, head-tail-connector and RNA polymerase. I like to upload my files to eggnog-mapper.
-
If you don't want to do this, you can cluster your genes using an iterative hmmscan (PSI-BLAST like), which groups similar protein calls together. Then you could pick the top 10 biggest clusters or only include genes that are present in at least 50% of all viruses.
To do this, using your concatinated proteins file, reformat it so that the FASTA goes from a multi line fasta to a single line fasta with this awk script.
awk '/^>/ { if(NR>1) print ""; printf("%s\n",$0); next; } { printf("%s",$0);} END {printf("\n");}' < all_SAR11_phages.faa > new_db.faa
Then for every entry (protein sequence) in the database, I use jackhmmer, which first searches for simular sequences within out database using nhmmer. Any simular sequences are concatinated together to make a new HMM that is used to search the database again to enlarge the cluster. This is repeated until no new sequences are added to the cluster.
We then remove the clustered sequences from the database so we don't search for the sequences already assigned to a cluster. This also rapidly speeds up the search. (45k protein sequences took ~15 mins on 8 threads for me without cluster removal). If your computer is multithreaded I highly recomend you use the --cpu option to speed up jackhmmer. I have also made the inclusion threshold higher from 1E-02 to 1E-06 (About 1 false positive would be expected in every 1M searches) and included more iterative rounds (from 5 to 10, just to be safe).
mkdir outdir
for i in $(grep ">" new_db.faa | sed 's/>//g; s/[[:space:]].*//g'); do
head -n 2 new_db.faa | jackhmmer --tblout jkhmr.tbl --notextw --cpu 2 -N 10 --incE 0.000001 - new_db.faa;
grep -v "^#" jkhmr.tbl | tr -s ' ' | cut -d " " -f1,19- | grep -f - -A 1 new_db.faa | sed "/^--$/d" - > outdir/${i}.clstr;
cat outdir/${i}.clstr | grep -v -f - new_db.faa > tmp.faa;
mv tmp.faa new_db.faa;
done
Lastly, I remove any clusters of small sizes (I actually move them to outdir/remove so you retain the sequences just in case). I chose to remove any cluster that does not include at least 50% of the number viruses tested (I tested 48 so: 48/2=24, BUT each entry includes a FASTA header and sequences so 24*2=48).
mkdir outdir/remove
find ./outdir/*.clstr -type f -exec awk -v x=48 'NR==x{exit 1}' {} \; -exec mv {} outdir/remove/ \;
Now within your outdir you have protein clusters and you can skip to tutorial step 2
- Create a file for each catagory of genes you have chosen.
capsid.faa
>VIRSorter_AAJR_prophage_000000000025_1 # 1 # 765 # 1 # ID=25_1;partial=11;start_type=Edge;rbs_motif=None;rbs_spacer=None;gc_cont=0.318
MVDKIEINQDENNISLEEQSNKQETNSQTTPEAQTKETSSEKPSWLPDKFSNAEELAKAYSELEKKFSSPSIEENKSYENKKTDLTIKQSEEAEQGKLDKFYNEYAETGKLTDTSYNELNKLGLDRQVVDGYIDGQTALSEQKATSIMSTVGGKEQYSEMISWASKNLAPEEVQAFNHTIDSGSLEQAQLAIAGVQAKYNQNNAEPNLFSGNKTNSNLGYRSVGEMLKDINDPRYSTDSAFRADVEEKVKLSNAI
>VIRSorter_AACP_phage_000000000014_1 # 1 # 801 # 1 # ID=14_1;partial=11;start_type=Edge;rbs_motif=None;rbs_spacer=None;gc_cont=0.353
MSTDRLEVKPDDNNNETLEQSAEKLKEQGVDINKDLSVNPNGEGIEVREPKVETESTEKRPEWLPEKFQNAEELAKAYGTLEKEFSGRTKEEVKPTEEVKADEAPQTGLDKYYEEFADKGELAEKSYSELAKLGLDKNLVDTYIEGQKLVSETNTKAIQDIAGGKEEYTELVEWAGKNLSEAETKVFNDMVDGGDIETAKFAVQGLMAKSGANPKQPSLYEGTSDTVSKDAFASVAQVTEAMNDPRYDSDPAYRQLVEDKIGRSTVL
>VIRSorter_AALP_phage_000000000004_1 # 1 # 822 # 1 # ID=4_1;partial=11;start_type=Edge;rbs_motif=None;rbs_spacer=None;gc_cont=0.347
MSTDRVEIKPDAIEKSLEQSAEDLKTNDGVDVSKDVAVNKSGEGARINELSQEDLQQSTEDKPDWLPSKFKNAEELAKAYGELEKSFSSRKQEEAPKETSIPEVRKPTEGQEALGKFYDEYAANSSLSDKSYEELATKHGLSKELVDGYIEGQKAIGDNQTKAIHDLTGGGEKYTELMDWAGKNLSEQEQQAYNSMVDSGNVDAAKLAVQGLMSKAGVNYNPKQPELFEGGDQIPNDSFESVSQVTEAMNDPRYAKDPAYRKKVTDKIARSSVI
[...]
- Run
muscleandtrimalon the genes to generate a multiple sequence alignment and refine it
muscle -in capsid.faa -out capsid.msa
trimal -in capsid.msa -out capsid.afa -automated1 -keepseqs
It should look something like this:
cat capsid.afa
>VIRSorter_AALP_phage_000000000009_1 # 1 # 948 # 1 # ID=9_1;partial=11;start_type=Edge;rbs_motif=None;rbs_spacer=None;gc_cont=0.373
MSNANTSRLGLVND-TGTSYDALFLKVFSGE--------VLASFGRENKMLDMTTV--RT
IGSGKSA----TFPVTGTIASSYHTAGNEILGTAVNHNE----RIINIDDMLISHAFIAE
IDELKNHFDARSIYSNEMGRALSNK--VDQHLVQLMVLASQASATITGGNGGYEITDADA
KTNAESLIASVFDANQKLDENDVPTSDRYVVVTPDVYYQLCN--VDKLISRDFSKNNGDF
GSGTVVSIAGIPVVKSNSAKLAYDDNSGAISGTNNTYNVDAQHIAATVFH--KSAVGTVK
[...]
- Build your Hidden Markov Model (HMM) for searching for simular genes
hmmbuild capsid.hmm capsid.afa
It should look like this:
cat capsid.hmm
HMMER3/f [3.3 | Nov 2019]
NAME capsid
LENG 221
ALPH amino
RF no
MM no
CONS yes
CS no
MAP yes
DATE Mon Jun 1 11:22:15 2020
NSEQ 5
EFFN 0.893555
CKSUM 1592742671
STATS LOCAL MSV -10.4788 0.70418
STATS LOCAL VITERBI -11.2667 0.70418
STATS LOCAL FORWARD -4.8939 0.70418
HMM A C D E F G H I K L M N P Q R S T V W Y
m->m m->i m->d i->m i->i d->m d->d
COMPO 2.46880 4.69472 2.73572 2.49653 3.47874 2.83545 3.82868 2.96866 2.56685 2.56273 3.82548 2.90495 3.54610 3.04849 3.03048 2.55907 2.83349 2.75135 4.74168 3.42452
2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503
[...]
-
Now we want an MSA of all the genes against of the genomes. This is done using
hmmalignwhich extracts the region of the genome that matches the HMM model. Important: The HMM must be run against all of the genomes one by one, not the other way around. I.e capsid.hmm needs to be run against phage_1 phage_2 before head_tail_connector.hmm is run against phage 1 and phage_2. Otherwise you will have and MSA with an unequal length as it needs to include insertion/delation events in all tested viruses.For every hmm model I have created in my working directory, run
hmmalignand only include the location of the genome that my HMM matches(--trim)and output this in the Pfam MSA format with the name beingcapsid_genes_global.msa.This will take about 30 seconds per HMM
for i in *.hmm; do echo $i; hmmalign --trim --outformat Pfam -o $(basename $i .hmm)_global.afa $i SAR11_phage.faa; done
Then for every global.msa I have created, trim it so I only include the useful information and put it into a trimmed file
for i in *global*; do egrep -v "#|//|^$" $i | sed -E -e 's/[[:blank:]]+/\n/g; s/^/>/g' > $(basename $i _global.msa)_trm.msa; done
Now this provides the last oppertunity to trim MSAs before they are concatinated into one file. So we refined them with muscle and trimal
for i in *_trm.msa; do muscle -in $i -out $(basename $i .msa).afa; trimal -in $(basename $i .msa).afa -out $(basename $i .msa)_final.msa -automated1 -keepseqs; done
Then for every phage I have in my file of all phage genomes, remove the MSA of each gene for each phage, concatinate it into one long MSA and append the viral name to the top, then concat the files into one file.
for i in *_trm_final.msa; do awk '/^>/ {printf("\n%s\n",$0);next; } { printf("%s",$0);} END {printf("\n");}' $i > $(basename $i .msa).afa; done # convert multi-contig fasta into one contig
for i in $(grep ">" SAR11_phage.faa); do MSA=$(grep $i -A 1 -h *_trm_final.afa | sed 's/^--$//g; /^$/d' | awk 'NR%2==0' ORS=''); echo $i$'\n'$MSA >> viral.msa; done
cat viral.msa
>Bylgja_VP3
KTFENESRPEWLPEKFKSPEDMAKAYGELKEETNKAEKAVENAGLNMSSLQEEYNEGGQLKYVFDLESNGLYTIHCIVLKDIETNKIIQDVNEALKLLSEAELIIGHNIIKYDIPVLKKLSVKNFKNFLYLAWKHLSLPEPTEIQYDLADFLQEPNKRIVIEAFRGVGKSWITSAFVCHQTLHAEETQGKYLVASEIEDLKEKLGADKVIVALTDKNNFRKDVLPTYKDNPLRKFLIDEYKDTAENRYESLSEIKEHYLDRGRECSELTIP--TLIPEQHQTQSSDFQSVGSRGVNNLASELVQGPLIKRKINKETVTKFNYQTGGKNV--QIANYYDKLVAQKLRY-PDKFQWIGDSKLLSGVIWDSMLSSARLGMSFLQNCAKVLSKNGHAIRWTNPVGFPVIQDYPEFKSMRVKTRMTELQAINTMLSFIGESPVSSITGNIGTDAKNILDETSMSVQSQGWFFN-RNVSTTRDTSN
>Eistla_VP4
ETQSTQSKPEGLPEKFNSVEDLAKSYAELEPKTETAEKAVADAGLDMSSLQQEYSEKGELKYIFDIETDGLMKIHCLVLKDVDSNQILSSVEEALDKLSKADVIIGHNIIKFDIPVIKKLRIKNFKNFLYLCWKHLNLPNPTPIQYDIADYLQSPEKRLVIEAFRGVGKSWITSAFVCHQ-----------------------LEADDYVVALTDSKNFRKDVLPTYKNNALREYVIKKHQQSAKQRYETLKQHREHFLDRAQECSELTIP--SLIPPDGFHSSTDFQSVGARGVNNLASDFISGALSKRNIDFNTAQKFNYQTGGRPC--QIANYYDKLVAQKLRY-PDKFQWLGDAKLLAAVIWDSILKSARIGMDYLQTIARIVAKEQLPVHWVTPVGFPVYQSYPEMKSKRVKAMLTELQAINIMLSVIGEAPVNSITGTTSVDAKNILDETSMSIQSQGWHFNTHYTSLALDQDN
>Eyrgjafa_VP5
DKSTDDVRPSWLPEKFKSAEDMAKAYSEL-EKKQSQMRADAEAGEGMDKFYTEYQDKGELKIILDLETNGFLVIHCIVCKDIETHQVYKNLNDCLELLNKVEAIIGHNVLGFDLPVLKRCKINDFRNFLYLTWKHLRLPEPTPIQYDIADYLANGSTRCIISAFRGVGKSWITASYILWRTLHSDLGKGKTLLQQAINYYKEKTKSKEVILAFSDSKNFRKEFDKTYKSHPLRKWAEQNYKSLIESQYTKMEVDREQYLERARELAKLTIP--HLYPPKGANEATEYQSVGSRGVTNLASNMIDGALPSRKINSDTCKKFNYQTGGQPV--HIANYYDKIVAQKLRF-QDKFLWLGDVDLLYGLVFQQKLVSQMINDDIKQMTMGKAGNHQTGLKIICQCSLIILKNVIDGISNEITINKSELEAVNTILSTIGESPLNTLSGSLPVDAKNVLSEVSREVQSQGWHFNTHKVTLSRDTDN
[...]
- Check the MSA file is formatted correctly and remove duplicate phages if you wish using RAxML. Follow the onscreen suggestions and if you're happy with your MSA file (Or new one as I have used) you can start making your phylogenetic tree.
raxml-ng --check --msa viral.msa --model LG+G8+F --prefix T1 --data-type AA
raxml-ng --parse --msa viral.msa --model LG+G8+F --prefix T2 --data-type AA
6b. Other alternatives include muscle which can trim and refine your MSA or you can use trimal. You could also use IQ-TREE to make your phylogenetic tree.
muscle -in viral.msa -out viral.afa
trimal -in viral.msa -out viral.afa -automated1 -keepseqs # or not keep seqs
iqtree -s viral.afa -bb 1000 -m MFP
- Lets make the tree with raxml-ng. Here are some options: The tree you should use should be under {prefix}.raxml.support
# Just make me a standard tree with bootstrappings
raxml-ng --all --msa viral.msa --model GTR+G --prefix T3 --threads 1
# make a quick tree to check its rough structure
raxml-ng --search1 --msa viral.msa --model GTR+G --prefix T4 --threads 1
# make a tree with 50 random starting+most pasimonious trees, with 2000 rounds of bootstrapping
raxml-ng --all --msa viral.msa --model GTR+G --prefix T5 --threads 1 --tree pars{50},rand{50} --bs-trees 2000
After the tree has been compiled, I would recomend iTOL to view and edit the tree. Here is an example to how it should look.
7b. Because we are using a multi gene tree, genes can mutate and different rates #biology. Each gene may have mutations specific to them, therefore if we use the same model for all genes, this may be incorrect. To get around this, we partition up an MSA by genes, and run a model on each, combining the results after. IMPORTANT: This does not affect the structure of the tree drastically (if at all) so is not recomended, but I have included this just in case. To do this, you need to make a file like below. You may need to do some re-jiggling of the numbers if your MSA file has been trimmed. IMPORTANT: If you are making a tree of organisms that are very closely related, you need the dev verion of raxml-ng
for i in *_trm_final.afa; do echo $i $(grep -v ">" $i | awk 'NR%2==0' | head -n 1 | wc -c); done
capsid_trm_final.afa 181
dna_pol_trm_final.afa 488
endonuclease_trm_final.afa 458
exonuclease_trm_final.afa 192
head_tail_trm_final.afa 433
helicase_trm_final.afa 408
rna_pol_trm_final.afa 176
tube_trm_final.afa 135
cat viral.part
LG+G8+F, capsid=1-180
LG+G8+F, dna_pol=181-667
LG+G8+F, endonuclease=668-1124
LG+G8+F, exonuclease=1125-1315
LG+G8+F, head_tail=1316-1747
LG+G8+F, helicase=1748-2154
LG+G8+F, rna_pol=2155-2329
LG+G8+F, tube=2330-2463
raxml-ng --all --msa viral.afa --model viral.part --prefix PARTITION_MODEL --threads 16 --tree pars{50},rand{50} --bs-trees 1000
If you want to learn more about the options for RAxML, I highly recomend their tutorial
NOTE: If any of the raxml-ng commands fail, rerun the command, they have checkpoints and so your progess won't be lost.