Skip to content

Latest commit

 

History

425 Commits

Folders and files

NameName
Last commit message
Last commit date
 
 
 
 
 
 
 
 
 
 

Repository files navigation

DOI

HANNO: efficient High-throughput ANNOtation of protein coding genes in eukaryote genomes

  • Outperforms most methods in speed by a factor of at least 10-20X
  • Can annotate a large vertebrate genome in below 1h.
  • Includes functional annotation using eggNog, protein homology and BUSCO.
  • Transcript models include UTRs
  • Works well with medium diverged input evidence (i.e. using NCBI Refseq annotations of species that diverged less than 50 MYA).
  • No need for RNAseq from your organism (but still beneficial of course)
  • Completely evidence based.
  • No repeat masking necessary
  • Tested on: Ubuntu 16.04.7 LTS, Ubuntu 22.04.3 LTS, Fedora 8.8

You will need MAMBA for installation!

To install conda/mamba see https://github.com/conda-forge/miniforge

#if you have conda already installed do
conda create -n MAMBA -c conda-forge mamba
conda activate MAMBA

Installation (tested on: Ubuntu 16.04.7 LTS, Ubuntu 22.04.3 LTS)

git clone https://github.com/HMPNK/HANNO.git
cd HANNO
chmod -R 750 scripts/*
mamba create -n HANNO -c conda-forge -c bioconda python=3.11.8 bedtools=2.27.1 seqtk samtools minimap2 miniprot last stringtie eggnog-mapper transdecoder ucsc-gtftogenepred ucsc-genepredtobed busco=3.0.2 perl-bioperl mawk
#it is important to install bedtools=2.27.1 , I had massive issues using bedtools v2.31.1 ("bedtools intersect" showing strange behaviour!)
#it is important to install busco=3.0.2 as some important outputs changed in newer version!
#it is important to install python=3.11.8 as we recently had issues using python 3.12.8 (BUSCO failed)

mamba activate HANNO

pip install pandas==2.2.3
#library needed for "bedDB_to_gtf_gff.py" the new bedDB to NCBI refSeq-like gff/gtf converter (pandas version 3.0.2, is not working!)

## TACO is not compatible with the environment create its own:
mamba create -n TACO -c conda-forge -c bioconda taco

## get EGGNOG DATA
mkdir EGGNOGG-DBs
export EGGNOG_DATA_DIR=$PWD/EGGNOGG-DBs/
download_eggnog_data.py
##It seems the server domain for database changed to "http://eggnog5.embl.de/. If downloads fail, one might have to change that in the "download_eggnog_data.py" script!

## get BUSCO databases from https://busco-data.ezlab.org/v5/data/lineages/
## For example fishes:
wget https://busco-data.ezlab.org/v5/data/lineages/actinopterygii_odb10.2024-01-08.tar.gz
tar xvf actinopterygii_odb10.2024-01-08.tar.gz
rm actinopterygii_odb10.2024-01-08.tar.gz

##change paths in main script "HANNO.v0.6.pl" to fit to your system:

my $scr = "/path_to/HANNO/scripts";
my $mamba="/path_to/miniconda2/envs/MAMBA/bin";
my $eggnog="/path_to/HANNO/EGGNOGG-DBs";

#IMPORTANT sometimes the script run_BUSCO.py is not available (check by "which run_BUSCO.py" !). If it is not available, add it like this to the HANNO environment bin dir:
find $HOME/ | grep HANNO | grep run_BUSCO.py$
#this should output /path/to/run_BUSCO.py
#change permissions for this file:
chmod 770 /path/to/run_BUSCO.py
#copy file to bin directory of HANNO environment, similar like this example:
cp /home/user/miniconda2/envs/MAMBA/envs/HANNO/lib/python3.7/site-packages/busco/run_BUSCO.py /home/user/miniconda2/envs/MAMBA/envs/HANNO/bin/run_BUSCO.py
#check again
which run_BUSCO.py

## now it should be ready to run, try to execute:
scripts/HANNO.v0.6.pl

HANNO version 0.6 (High-throughput ANNOtation for eukaryote genomes)
Author: Heiner Kuhl, Phd (heiner.kuhl@igb-berlin.de)

THIS SCRIPT CREATES THE PIPELINE AS A BASH script

INPUT DATA: genome assembly, proteins and mRNAs from related organism or denovo transcriptome assemblies, gtf from stringtie reference guided transcriptome assembly, BUSCO database

ALWAYS USE RELATIVE PATH (e.g. "../../assembly/asm.fasta"), IF INPUT data is not in current directory!

      Options:
  		-a your genome assembly (fasta, fasta.gz)
  		-d output directory to be created
  		-p proteins used for gene-modeling (fasta, fasta.gz)
  		-r mRNAs to be used for gene modeling (fasta, fasta.gz)
  		-g stringtie assembled transcripts (gtf, be sure the gtf was created using the genome assembly provided with \"-a\" )
  		-b path to busco lineage database (e.g. /home/user/eukaryota_odb9)
  		-B BUSCO only on all Models (0=on; 1=off, default=0)
  		-P PROTEIN DB for functional annotation (fasta)
  		-t number of threads to use (default 8)
		-E skip EGGNOG functional annotation (0 or 1=skip, default=0)
		-U polish UTRs (default=true, no=false), recommended if using diverged mRNA evidence (will remove surplus UTR exons far fom CDS)

This script generates a bash script for running the pipeline! Write script to file and run by: nohup bash <script> & !
ERROR: NEED an assembly to annotate!!!

## test HANNO INSTALLATION:
mamba activate HANNO
bash TTN-TEST-RUNS.sh

##This will run all use cases of the pipeline on the largest known vertebrate gene TTN
##CHECK the logs for early stops
##If the pipeline finishes successfully all logs will start and end with a date
##Do not wonder that BUSCO results are 0%, the TTN gene tested is not present in the BUSCO db used.
##If an error like "gtf_to_alignment_gff3.pl not found" occurs in the log files. The transdecoder util directory files need to be linked into the miniforge or miniconda envs/HANNO/bin directory:
cd /path/to/miniforge3/envs/HANNO/bin
ln -s ../opt/transdecoder/util/* .
##The error above occured on a new Ubuntu 2024 installation with miniforge3 install.
##If awk errors related to "asort" occur install gawk on the system (by "sudo apt install gawk"). This error occured on a new Ubuntu 2024 installation.
##If the runs with eggnog do not finish correctly, some issue with the eggnog DB download might persist. Sometimes happens due to server connection issues. Try a manual download from http://eggnog5.embl.de/download/
##If errors ocurred remove prior outputs of test runs and rerun the tests:
rm RUN-TEST1-p* -rf
grep RUN-TEST1-p TTN-TEST-RUNS.sh | bash

Input files

  • Proteins ("-p" / "-P") should be formatted like they come from NCBI to make use of it in functional annotation:

    >XP_032605298.2 titin [Taeniopygia guttata] MTTKAPTFTQPLQSVVALEGSAATFEAHISGFPVPEVNWFRDGQVLSAATLPGVQISFSDGRARLVIP...

  • If no input via "-P", protein input via "-p" will be used for gene-modeling and for functional annotation.
  • If input via "-p" and "-P", "-p" will be used for modelling and -P will be used for functional annotation.
  • long RNA sequence (Refseq mRNA, ISOSEQ from your organism) should be input via "-r"
  • If using NCBI Refseq *rna_from_genomic* files, consider removing "miscrna", "ncrna", "precursorrna", "rrna" and "trna" to increase gene-level precision! This is especially true, if the human genome reference geneset is used as it contains much more of these non-coding RNAs than other annotations, which will induce HANNO to build more spurious gene-models! Similarly, if too many genes are predicted when using RNAseq or Helixer inputs (often occurs, if de novo transcript assemblies are used!), one may consider removing transcripts which have no functional annotations by eggNog, BUSCO or protein homology from the output files.
#remove non-coding RNAs from NCBI RefSeq "*rna_from_genomic*" input:
seqtk comp GCF_009914755.1_T2T-CHM13v2.0_rna_from_genomic.fna.gz | grep  -vE 'miscrna|ncrna|precursorrna|rrna|trna' | cut -f 1 | seqtk subseq GCF_009914755.1_T2T-CHM13v2.0_rna_from_genomic.fna.gz /dev/stdin | gzip -c > GCF_009914755.1_T2T-CHM13v2.0_mRNA_from_genomic.fna.gz

#Alternatively, screen functionally annotated gene models after HANNO run (if de novo or reference guided assembled RNAseq or Helixer annotation was used as input):
awk 'BEGIN{OFS="\t";FS="\t"} {if($26!="-" || $39!="-" || ($21>60 || $17>300)){print}}' BESTMODELS-FINAL.bedDB > BESTMODELS-FINAL-with-DB-hits.bedDB
  • short read RNAseq should be assembled reference guided by stringtie and the resulting gtf should be input by "-g"
  • Alternatively, but time consuming, denovo assemblies of short read RNAseq can be input via "-r".
  • Currently, HANNO will run only, if a protein input is provided. To override this to check performance on pure transcript data, one may input a single mappable protein via "-p".
  • see use cases below

Output files

  • ALLMODELS-FINAL.bedDB -> bed12 like Database of all transcript models and all assigned functional information

  • BESTMODELS-FINAL.bedDB -> putative best scoring transcript models for each transcript cluster from above

  • BESTMODELS-FINAL.gff3 -> same as above as gff3 format

  • BESTMODELS-FINAL.gtf -> same as above as gtf format

  • BESTMODELS-FINAL.mRNA.fa -> corresponding mRNA sequences as fasta

  • BESTMODELS-FINAL.CDS.fa -> corresponding CDS sequences as fasta

  • BESTMODELS-FINAL.AA.faa -> corresponding aminoacid sequences as fasta

  • tandemdup-issues.bedDB -> transcript models with putative fused genes, removed from final output (since v0.6)

    Note that "*.bedDB" files can be viewed in IGV, after renaming them to "*.bed". Due to the one-line format, they can also be browsed and edited in a table calculation software. For instance one can add fields of functional annotations (fields 13 to xy) to the bed name field (field 4) to add more information to the IGV visualization.

#Example for adding functional annotation from ".bedDB" to ".bed" for viewing in IGV (using field 26=gene symbol by eggNog and field 15=description from best protein hit):
awk 'BEGIN{FS="\t";OFS="\t"} {$4=$26" | "$15" | "$4;print}' BESTMODELS-FINAL.bedDB | cut -f1-12 > BESTMODELS-FINAL.for-IGV.bed

bedDB to NCBI refSeq-like GFF3/GTF conversion

A more convinient way to view annotations in IGV and for usage in other tools is the conversion of the *bedDB files to NCBI compatible gff or gtf. This is now possible with the script "bedDB_to_gtf_gff.py". Here you will also have options to extract annotated fasta files of mRNA and CDS sequences, if a genome fasta file is provided. This also allows for viewing mRNA and CDS sequences in IGV, when clicking on a transcript model. This conversion script has been integrated in HANNO version 0.5, recently.

#Examples for bedDB_to_gtf_gff.py

#Convert to NCBI RefSeq-like gtf
python /path_to_scripts/bedDB_to_gtf_gff.py BESTMODELS-FINAL.bedDB -o refSeq-like.gtf

#Convert to NCBI RefSeq-like gff
python /path_to_scripts/bedDB_to_gtf_gff.py BESTMODELS-FINAL.bedDB --gff -o refSeq-like.gff

#Convert to NCBI RefSeq-like gff including mRNA and CDS sequence in gff
python /path_to_scripts/bedDB_to_gtf_gff.py BESTMODELS-FINAL.bedDB --gff --genome assembly.fasta -o refSeq-like.gff

#Convert to NCBI RefSeq-like gff including mRNA and CDS sequence in gff and fasta files
python /path_to_scripts/bedDB_to_gtf_gff.py BESTMODELS-FINAL.bedDB --gff --fasta --genome assembly.fasta -o refSeq-like.gff
#CDS fasta can be translated to protein fasta (uses sed to keep additional infos in fasta header, which otherwise would be lost)
cat CDS_sequences.fasta | sed "s/ /::/g" | perl /path_to_scripts/translate.perl | sed "s/::/ /g" > AA_sequences.fasta

#You can also do the above for "ALLMODELS-FINAL.bedDB", if you are interested in alternative gene models / isoforms
#CHECK UPDATE ON "IMPROVING ISOFORM ANNOTATION (GTF only input)" section below!

POLISH MULTI-EXON UTRs

Sometimes fragmented 5'UTRs and 3'UTRs occur (if too diverged mRNAs are used for gene-modeling, frameshifts in the genome sequence occur, or due to RNAseq mapping noise), polishing the transcripts by removing end-standing UTR exons can be done by a script. This has been integrated by default since HANNO pipeline version 0.5 (switch off by "-U false" parameter).

awk -v cdsdist=300 -f /path_to_scripts/clean-bed12-utrs.awk BESTMODELS-FINAL.bedDB > BESTMODELS-FINAL.cleanUTR.bedDB
#use "python /path_to_scripts/bedDB_to_gtf_gff.py BESTMODELS-FINAL.cleanUTR.bedDB ..." to get gff/gtf and annotated sequences from the cleaned bedDB

IMPROVING ISOFORM ANNOTATION (GTF only input)

The HANNO pipeline tries to identify a best gene-model per gene by default. To annotate reliable isoforms for your organism one should use RNAseq of the same species ONLY. Find below a best-practise to incorporate isoforms from RNAseq in your HANNO annotation:

# first perform an annotation ("HANNO-V1") using HANNO for the different use cases as described above/below
# then re-assemble your RNAseq with stringtie using the HANNO BESTMODELS as reference:
stringtie -G HANNO-V1/BESTMODELS-FINAL.gff3 -p 2 -o yourspecies.gtf yourspecies-RNAseq.bam
#merge all assembled + reference transcripts
#you may adjust minimum FPKM and TPM here (-T 1 -F 1 (default), lower values will call more isoforms, but also more noisy gene models)
stringtie --merge -T 1 -F 1 -G HANNO-V1/BESTMODELS-FINAL.gff3 -p 2 -o yourspecies-alliso.gtf yourspecies.gtf
#run special version for annotation of CDS on StringTie transcripts and do functional annotation
path_to/HANNO/scripts/HANNO.StringTie-GTFonly.v0.6.pl -d HANNO-V2 -g yourspecies-alliso.gtf -a referencegenome.fa -P referenceprotein.faa -b buscodatabase -t 8 | bash > HANNO-V2.log 2>&1
#Output will be for ALLMODELS (all isoforms with different protein products) and BESTMODELS
#as before you may filter out spurious gene-models, that have no protein or EGGNOG matches
awk 'BEGIN{OFS="\t";FS="\t"} {if($26!="-" || $39!="-" || ($21>60 || $17>300)){print}}' HANNO-V2/ALLMODELS-FINAL.bedDB > HANNO-V2/ALLMODELS-FINAL-with-DB-hits.bedDB
awk 'BEGIN{OFS="\t";FS="\t"} {if($26!="-" || $39!="-" || ($21>60 || $17>300)){print}}' HANNO-V2/BESTMODELS-FINAL.bedDB > HANNO-V2/BESTMODELS-FINAL-with-DB-hits.bedDB

IMPROVING ANNOTATION OF TANDEM DUPLICATED GENES

Since version 0.6 HANNO tries to improve annotations of gene clusters and tandem gene duplications by identifying transcript models that fuse tandem duplicated genes. These models are removed, but stored in the file "tandemdup-issues.bedDB".

BENCHMARKING HANNO BY TEST-RUNS ON VERTEBRATE GENOMES

HANNO benchmark runtimes on different vertebrate clades (HPC-server: Intel(R) Xeon(R) CPU E7-8890 v4 @ 2.20GHz; 96-threads; 1TB RAM). Note that 6 (Birds, Amphibians), 8 (Fish) and 11 (Mammals) genome annotations were run in parallel.

image

Note that speed of HANNO can be increased significantly by switching off BUSCO and/or eggNog steps (no "-b" provided and/or "-E 1" ) on the cost of reduced efficency of best-model selection (see comparisons with LiftOn and Tiberius below).

HANNO was tested on fish (n=8), amphibian (n=6), bird (n=6) and mammal genomes (n=11), by transferring Refseq Annotations (from P. flavescens, B. bufo, T. guttata and H. sapiens) to closely related and diverged species. Results below show the trends for "Complete", "Fragmented" and "Missing" BUSCOs for species ordered by divergence time from reference species (confidence intervalls from www.timetree.org) as well as total recovery of CDS and UTR compared to the 0 MYA diverged reference genome. HANNOtations of genomes by reference proteins and mRNA that diverged less than 50 MYA are typically yielding good results in terms of total recovered CDS and UTR sequences and BUSCO statistics for all vertebrate clades tested.

image

image

image

image

image

#test-runs on diverged vertebrate genomes
mamba activate HANNO

#remove non-coding RNAs from input:
seqtk comp GCF_905171765.1_aBufBuf1.1_rna_from_genomic.fna.gz | grep  -vE 'miscrna|ncrna|precursorrna|rrna|trna' | cut -f 1 | seqtk subseq GCF_905171765.1_aBufBuf1.1_rna_from_genomic.fna.gz /dev/stdin | gzip -c > GCF_905171765.1_aBufBuf1.1_mRNA_from_genomic.fna.gz
#AMPHIBIANS                 
../scripts/HANNO.v0.6.pl -t 12 -d HANNO-BUFVIR-v0.4-mRNA -a GCA_037900795.1_ASM3790079v1_genomic.fna.gz -p GCF_905171765.1_aBufBuf1.1_protein.faa.gz -r GCF_905171765.1_aBufBuf1.1_mRNA_from_genomic.fna.gz -b vertebrata_odb9 | bash > HANNO-BUFVIR-v0.4-mRNA.log 2>&1
../scripts/HANNO.v0.6.pl -t 12 -d HANNO-LEPFUS-v0.4-mRNA -a GCA_031893025.1_aLepFus1.hap1_genomic.fna.gz -p GCF_905171765.1_aBufBuf1.1_protein.faa.gz -r GCF_905171765.1_aBufBuf1.1_mRNA_from_genomic.fna.gz -b vertebrata_odb9 | bash > HANNO-LEPFUS-v0.4-mRNA.log 2>&1
../scripts/HANNO.v0.6.pl -t 12 -d HANNO-XENTRO-v0.4-mRNA -a GCF_000004195.4_UCB_Xtro_10.0_genomic.fna.gz -p GCF_905171765.1_aBufBuf1.1_protein.faa.gz -r GCF_905171765.1_aBufBuf1.1_mRNA_from_genomic.fna.gz -b vertebrata_odb9 | bash > HANNO-XENTROP-v0.4-mRNA.log 2>&1
../scripts/HANNO.v0.6.pl -t 12 -d HANNO-SPEBOM-v0.4-mRNA -a GCF_027358695.1_aSpeBom1.2.pri_genomic.fna.gz -p GCF_905171765.1_aBufBuf1.1_protein.faa.gz -r GCF_905171765.1_aBufBuf1.1_mRNA_from_genomic.fna.gz -b vertebrata_odb9 | bash > HANNO-SPEBOM-v0.4-mRNA.log 2>&1
../scripts/HANNO.v0.6.pl -t 12 -d HANNO-BOMBOM-v0.4-mRNA -a GCF_027579735.1_aBomBom1.pri_genomic.fna.gz -p GCF_905171765.1_aBufBuf1.1_protein.faa.gz -r GCF_905171765.1_aBufBuf1.1_mRNA_from_genomic.fna.gz -b vertebrata_odb9 | bash > HANNO-BOMBOM-v0.4-mRNA.log 2>&1
../scripts/HANNO.v0.6.pl -t 12 -d HANNO-BUFBUF-v0.4-mRNA -a GCF_905171765.1_aBufBuf1.1_genomic.fna.gz -p GCF_905171765.1_aBufBuf1.1_protein.faa.gz -r GCF_905171765.1_aBufBuf1.1_mRNA_from_genomic.fna.gz -b vertebrata_odb9 | bash > HANNO-BUFBUF-v0.4-mRNA.log 2>&1
                 
#BIRDS
#remove non-coding RNAs from input:
seqtk comp GCF_003957565.2_bTaeGut1.4.pri_rna_from_genomic.fna.gz | grep  -vE 'miscrna|ncrna|precursorrna|rrna|trna' | cut -f 1 | seqtk subseq GCF_003957565.2_bTaeGut1.4.pri_rna_from_genomic.fna.gz /dev/stdin | gzip -c > GCF_003957565.2_bTaeGut1.4.pri_mRNA_from_genomic.fna.gz
#                 
../scripts/HANNO.v0.6.pl -t 12 -d HANNO-TAEGUT-V0.4-mRNA -a GCF_003957565.2_bTaeGut1.4.pri_genomic.fna.gz -p GCF_003957565.2_bTaeGut1.4.pri_protein.faa.gz -r GCF_003957565.2_bTaeGut1.4.pri_mRNA_from_genomic.fna.gz -b aves_odb9 | bash > HANNO-TAEGUT-V0.4-mRNA.log 2>&1
../scripts/HANNO.v0.6.pl -t 12 -d HANNO-SERCAN-V0.4-mRNA -a GCF_022539315.1_serCan2020_genomic.fna.gz -p GCF_003957565.2_bTaeGut1.4.pri_protein.faa.gz -r GCF_003957565.2_bTaeGut1.4.pri_mRNA_from_genomic.fna.gz -b aves_odb9 | bash > HANNO-SERCAN-V0.4-mRNA.log 2>&1
../scripts/HANNO.v0.6.pl -t 12 -d HANNO-MYICAY-V0.4-mRNA -a GCF_022539395.1_myiCay2020_genomic.fna.gz -p GCF_003957565.2_bTaeGut1.4.pri_protein.faa.gz -r GCF_003957565.2_bTaeGut1.4.pri_mRNA_from_genomic.fna.gz -b aves_odb9 | bash > HANNO-MYICAY-V0.4-mRNA.log 2>&1
../scripts/HANNO.v0.6.pl -t 12 -d HANNO-PHASUP-V0.4-mRNA -a GCA_023637945.1_DD_ASM_B1_genomic.fna.gz -p GCF_003957565.2_bTaeGut1.4.pri_protein.faa.gz -r GCF_003957565.2_bTaeGut1.4.pri_mRNA_from_genomic.fna.gz -b aves_odb9 | bash > HANNO-PHASUP-V0.4-mRNA.log 2>&1
../scripts/HANNO.v0.6.pl -t 12 -d HANNO-GALGAL-V0.4-mRNA -a GCF_016699485.2_bGalGal1.mat.broiler.GRCg7b_genomic.fna.gz -p GCF_003957565.2_bTaeGut1.4.pri_protein.faa.gz -r GCF_003957565.2_bTaeGut1.4.pri_mRNA_from_genomic.fna.gz -b aves_odb9 | bash > HANNO-GALGAL-V0.4-mRNA.log 2>&1
../scripts/HANNO.v0.6.pl -t 12 -d HANNO-DROHOL-V0.4-mRNA -a GCA_016128335.2_ZJU2.0_genomic.fna.gz -p GCF_003957565.2_bTaeGut1.4.pri_protein.faa.gz -r GCF_003957565.2_bTaeGut1.4.pri_mRNA_from_genomic.fna.gz -b aves_odb9 | bash > HANNO-DROHOL-V0.4-mRNA.log 2>&1
                 
#FISHES                 
#remove non-coding RNAs from input:
seqtk comp GCF_004354835.1_PFLA_1.0_rna_from_genomic.fna.gz | grep  -vE 'miscrna|ncrna|precursorrna|rrna|trna' | cut -f 1 | seqtk subseq GCF_004354835.1_PFLA_1.0_rna_from_genomic.fna.gz /dev/stdin | gzip -c > GCF_004354835.1_PFLA_1.0_mRNA_from_genomic.fna.gz
#
../scripts/HANNO.v0.6.pl -t 8 -d HANNO-PERFLA-V0.4-mRNA -a GCF_004354835.1_PFLA_1.0_genomic.fna.gz -p GCF_004354835.1_PFLA_1.0_protein.faa.gz -r GCF_004354835.1_PFLA_1.0_mRNA_from_genomic.fna.gz -b actinopterygii_odb9 | bash > HANNO-PERFLA-V0.4-mRNA.log 2>&1
../scripts/HANNO.v0.6.pl -t 8 -d HANNO-SANLUC-V0.4-mRNA -a GCF_008315115.2_SLUC_FBN_1.2_genomic.fna.gz -p GCF_004354835.1_PFLA_1.0_protein.faa.gz -r GCF_004354835.1_PFLA_1.0_mRNA_from_genomic.fna.gz -b actinopterygii_odb9 | bash > HANNO-SANLUC-V0.4-mRNA.log 2>&1
../scripts/HANNO.v0.6.pl -t 8 -d HANNO-EPIFUS-V0.4-mRNA -a GCF_011397635.1_E.fuscoguttatus.final_Chr_v1_genomic.fna.gz -p GCF_004354835.1_PFLA_1.0_protein.faa.gz -r GCF_004354835.1_PFLA_1.0_mRNA_from_genomic.fna.gz -b actinopterygii_odb9 | bash > HANNO-EPIFUS-V0.4-mRNA.log 2>&1
../scripts/HANNO.v0.6.pl -t 8 -d HANNO-DICLAB-V0.4-mRNA -a GCF_905237075.1_dlabrax2021_genomic.fna.gz -p GCF_004354835.1_PFLA_1.0_protein.faa.gz -r GCF_004354835.1_PFLA_1.0_mRNA_from_genomic.fna.gz -b actinopterygii_odb9 | bash > HANNO-DICLAB-V0.4-mRNA.log 2>&1
../scripts/HANNO.v0.6.pl -t 8 -d HANNO-ESOLUC-V0.4-mRNA -a GCF_011004845.1_fEsoLuc1.pri_genomic.fna.gz -p GCF_004354835.1_PFLA_1.0_protein.faa.gz -r GCF_004354835.1_PFLA_1.0_mRNA_from_genomic.fna.gz -b actinopterygii_odb9 | bash > HANNO-ESOLUC-V0.4-mRNA.log 2>&1
../scripts/HANNO.v0.6.pl -t 8 -d HANNO-CLAGAR-V0.4-mRNA -a GCF_024256425.1_CGAR_prim_01v2_genomic.fna.gz -p GCF_004354835.1_PFLA_1.0_protein.faa.gz -r GCF_004354835.1_PFLA_1.0_mRNA_from_genomic.fna.gz -b actinopterygii_odb9 | bash > HANNO-CLAGAR-V0.4-mRNA.log 2>&1
../scripts/HANNO.v0.6.pl -t 8 -d HANNO-DANRER-V0.4-mRNA -a GCA_033170195.1_ASM3317019v1_genomic.fna.gz -p GCF_004354835.1_PFLA_1.0_protein.faa.gz -r GCF_004354835.1_PFLA_1.0_mRNA_from_genomic.fna.gz -b actinopterygii_odb9 | bash > HANNO-DANRER-V0.4-mRNA.log 2>&1
../scripts/HANNO.v0.6.pl -t 8 -d HANNO-ORENIL2-V0.4-mRNA -a GCF_001858045.2_O_niloticus_UMD_NMBU_genomic.fna.gz -p GCF_004354835.1_PFLA_1.0_protein.faa.gz -r GCF_004354835.1_PFLA_1.0_mRNA_from_genomic.fna.gz -b actinopterygii_odb9 | bash > HANNO-ORENIL2-V0.4-mRNA.log 2>&1
                 
#MAMMALS
#remove non-coding RNAs from input:
seqtk comp GCF_009914755.1_T2T-CHM13v2.0_rna_from_genomic.fna.gz | grep  -vE 'miscrna|ncrna|precursorrna|rrna|trna' | cut -f 1 | seqtk subseq GCF_009914755.1_T2T-CHM13v2.0_rna_from_genomic.fna.gz /dev/stdin | gzip -c > GCF_009914755.1_T2T-CHM13v2.0_mRNA_from_genomic.fna.gz                 
#run HANNO without ncRNA in -r input
../scripts/HANNO.v0.6.pl -t 6 -d T2T-CHM13v2.0.0.4-mRNA -a GCF_009914755.1_T2T-CHM13v2.0_genomic.fna.gz -p GCF_009914755.1_T2T-CHM13v2.0_protein.faa.gz -r GCF_009914755.1_T2T-CHM13v2.0_mRNA_from_genomic.fna.gz -b mammalia_odb10 | bash > T2T-CHM13v2.0.0.4-mRNA.log 2>&1
../scripts/HANNO.v0.6.pl -t 6 -d PanPan.0.4-mRNA -a GCF_029289425.1_NHGRI_mPanPan1-v1.1-0.1.freeze_pri_genomic.fna.gz -p GCF_009914755.1_T2T-CHM13v2.0_protein.faa.gz -r GCF_009914755.1_T2T-CHM13v2.0_mRNA_from_genomic.fna.gz -b mammalia_odb10 | bash > PanPan.0.4-mRNA.log 2>&1
../scripts/HANNO.v0.6.pl -t 6 -d PonAbe1.0.4-mRNA -a GCF_028885655.1_NHGRI_mPonAbe1-v1.1-hic.freeze_pri_genomic.fna.gz -p GCF_009914755.1_T2T-CHM13v2.0_protein.faa.gz -r GCF_009914755.1_T2T-CHM13v2.0_mRNA_from_genomic.fna.gz -b mammalia_odb10 | bash > PonAbe1.0.4-mRNA.log 2>&1
../scripts/HANNO.v0.6.pl -t 6 -d CalJa1.0.4-mRNA -a GCF_011100555.1_mCalJa1.2.pat.X_genomic.fna.gz -p GCF_009914755.1_T2T-CHM13v2.0_protein.faa.gz -r GCF_009914755.1_T2T-CHM13v2.0_mRNA_from_genomic.fna.gz -b mammalia_odb10 | bash > CalJa1.0.4-mRNA.log 2>&1
../scripts/HANNO.v0.6.pl -t 6 -d GRCm39.0.4-mRNA -a GCF_000001635.27_GRCm39_genomic.fna.gz -p GCF_009914755.1_T2T-CHM13v2.0_protein.faa.gz -r GCF_009914755.1_T2T-CHM13v2.0_mRNA_from_genomic.fna.gz -b mammalia_odb10 | bash > GRCm39.0.4-mRNA.log 2>&1
../scripts/HANNO.v0.6.pl -t 6 -d ARS-UCD2.0.0.4-mRNA -a GCF_002263795.3_ARS-UCD2.0_genomic.fna.gz -p GCF_009914755.1_T2T-CHM13v2.0_protein.faa.gz -r GCF_009914755.1_T2T-CHM13v2.0_mRNA_from_genomic.fna.gz -b mammalia_odb10 | bash > ARS-UCD2.0.0.4-mRNA.log 2>&1
../scripts/HANNO.v0.6.pl -t 6 -d ARS1.2.0.4-mRNA -a GCF_001704415.2_ARS1.2_genomic.fna.gz -p GCF_009914755.1_T2T-CHM13v2.0_protein.faa.gz -r GCF_009914755.1_T2T-CHM13v2.0_mRNA_from_genomic.fna.gz -b mammalia_odb10 | bash > ARS1.2.0.4-mRNA.log 2>&1
../scripts/HANNO.v0.6.pl -t 6 -d OrcOrc.0.4-mRNA -a GCF_937001465.1_mOrcOrc1.1_genomic.fna.gz -p GCF_009914755.1_T2T-CHM13v2.0_protein.faa.gz -r GCF_009914755.1_T2T-CHM13v2.0_mRNA_from_genomic.fna.gz -b mammalia_odb10 | bash > OrcOrc.0.4-mRNA.log 2>&1
../scripts/HANNO.v0.6.pl -t 6 -d RhiFer1.0.4-mRNA -a GCF_004115265.2_mRhiFer1_v1.p_genomic.fna.gz -p GCF_009914755.1_T2T-CHM13v2.0_protein.faa.gz -r GCF_009914755.1_T2T-CHM13v2.0_mRNA_from_genomic.fna.gz -b mammalia_odb10 | bash > RhiFer1.0.4-mRNA.log 2>&1
../scripts/HANNO.v0.6.pl -t 6 -d EleMax1.0.4-mRNA -a GCF_024166365.1_mEleMax1_primary_haplotype_genomic.fna.gz -p GCF_009914755.1_T2T-CHM13v2.0_protein.faa.gz -r GCF_009914755.1_T2T-CHM13v2.0_mRNA_from_genomic.fna.gz -b mammalia_odb10 | bash > EleMax1.0.4-mRNA.log 2>&1
../scripts/HANNO.v0.6.pl -t 6 -d phaCin.0.4-mRNA -a GCF_002099425.1_phaCin_unsw_v4.1_genomic.fna.gz -p GCF_009914755.1_T2T-CHM13v2.0_protein.faa.gz -r GCF_009914755.1_T2T-CHM13v2.0_mRNA_from_genomic.fna.gz -b mammalia_odb10 | bash > phaCin.0.4-mRNA.log 2>&1

IMPROVING ANNOTATION BY ADDING SPECIES-LEVEL TRANSCRIPTOME DATA (genus-level should work, too)

To benchmark improvement of annotation by adding species-level RNAseq short reads, the E. lucius run from above was supported by E. lucius brain, ovary and testis data. Results show improvement in BUSCO statistics is due to reduced number of fragmented BUSCOs. Annotated CDS-length is improved by 18% and UTR-length shows massive improvement. A run of Helixer AI gene prediction was added for comparison.

INCLUDING HELIXER ANNOTATION IN HANNO

Including the Helixer annotation into HANNO via the "-g" parameter can improve BUSCO scoring, but may cost a bit of gene-level precision. It seems to be a good choice, if only diverged reference proteins/mRNAs are available for your species.

image

image

#Build hisat2 index for genome to be annotated
hisat2-build -p 24 GCF_011004845.1_fEsoLuc1.pri_genomic.fna ESOLUC
#Map RNAseq data
hisat2 -p 16 --dta --summary-file ESOLUC.BRAIN.log -x ESOLUC -1 SRR1533652_1.fastq.gz -2 SRR1533652_2.fastq.gz -S ESOLUC.BRAIN.sam
hisat2 -p 16 --dta --summary-file ESOLUC.OVARY.log -x ESOLUC -1 SRR1533651_1.fastq.gz -2 SRR1533651_2.fastq.gz -S ESOLUC.OVARY.sam
hisat2 -p 16 --dta --summary-file ESOLUC.TESTIS.log -x ESOLUC -1 SRR1533661_1.fastq.gz -2 SRR1533661_2.fastq.gz -S ESOLUC.TESTIS.sam
#Convert SAM to BAM and sort
samtools sort -@16 -m 10G -o ESOLUC.BRAIN.srt.bam ESOLUC.BRAIN.sam
samtools sort -@16 -m 10G -o ESOLUC.OVARY.srt.bam ESOLUC.OVARY.sam
samtools sort -@16 -m 10G -o ESOLUC.TESTIS.srt.bam ESOLUC.TESTIS.sam

#remove SAM files to free disk:
rm *sam

#assemble transcripts from BAM-files:
stringtie -p 16 -l BRAIN -o ESOLUC.BRAIN.gtf ESOLUC.BRAIN.srt.bam
stringtie -p 16 -l OVARY -o ESOLUC.OVARY.gtf ESOLUC.OVARY.srt.bam
stringtie -p 16 -l TESTIS -o ESOLUC.TESTIS.gtf ESOLUC.TESTIS.srt.bam
#This took about 20 minutes (if running the 3 hisat2 jobs, the 3 samtools and the 3 stringtie jobs in parallel)

#just concatenate assembled trancript gtf-files prior to feeding it into HANNO:
cat ESOLUC.OVARY.gtf ESOLUC.TESTIS.gtf ESOLUC.BRAIN.gtf > ESOLUC.O+T+B.gtf

#TEST HANNO with transcriptome only (use dummy file to override HANNOS need for input "-p")
#create "dummy.faa" first that contains only a single protein sequence (must be a mappable one otherwise HANNO will stop, because miniprot gtf is empty)
seqtk seq -l 0 GCF_004354835.1_PFLA_1.0_protein.faa.gz | head -2 > dummy.faa
#Run HANNO (use all proteins via "-P" in functional annotation only)
../scripts/HANNO.v0.6.pl -t 80 -d HANNO-ESOLUC-V0.4-TRANS-only -a GCF_011004845.1_fEsoLuc1.pri_genomic.fna.gz -p dummy.faa -b actinopterygii_odb9 -g ESOLUC.O+T+B.gtf -P GCF_004354835.1_PFLA_1.0_protein.faa.gz | bash > HANNO-ESOLUC-V0.4-TRANS-only.log 2>&1
#Using 80 threads this took 34 minutes (mainly due to BUSCO and eggNog)!

#Run HANNO with proteins and mRNA from a diverged species and reference guided transcript assemblies from same species:
../scripts/HANNO.v0.6.pl -t 80 -d HANNO-ESOLUC-V0.4-TRANS -a GCF_011004845.1_fEsoLuc1.pri_genomic.fna.gz -p GCF_004354835.1_PFLA_1.0_protein.faa.gz -r GCF_004354835.1_PFLA_1.0_mRNA_from_genomic.fna.gz -b actinopterygii_odb9 -g ESOLUC.O+T+B.gtf | bash > HANNO-ESOLUC-V0.4-TRANS.log 2>&1

#Using 80 threads HANNO finished in 48 minutes!
#It was also tested to input denovo assembled instead of reference guided transcripts from the same species, but it delivers similar results and is much less efficient in terms of computing time (denovo transcript assembly takes too much time!)
#convert Helixer gff3 to stringtie-like gtf first:
#create helixer gtf as input for HANNO "-g"
awk -f ../scripts/helixergff3Togtf.awk HELIXER-GCF_011004845.1_fEsoLuc1.pri_genomic.fna.gff3 |gtfToGenePred stdin stdout | genePredToBed stdin stdout | awk -f ../scripts/bed12ToGTF_addscore-tacoFake.awk > helixer-input.gtf

#run HANNO with Helixer-annotation input via "-g"
../scripts/HANNO.v0.6.pl -t 80 -d HANNO-ESOLUC-V0.4+helixer -a GCF_011004845.1_fEsoLuc1.pri_genomic.fna.gz -p GCF_004354835.1_PFLA_1.0_protein.faa.gz -r GCF_004354835.1_PFLA_1.0_mRNA_from_genomic.fna.gz -b actinopterygii_odb9 -g helixer-input.gtf | bash > HANNO-ESOLUC-V0.4+helixer.log 2>&1

#to also add RNAseq, just concatenate helixer and stringtie gtfs
cat ESOLUC.O+T+B.gtf helixer-input.gtf > ESOLUC.O+T+B+Helixer.gtf
../scripts/HANNO.v0.6.pl -t 80 -d HANNO-ESOLUC-V0.4-trans+helixer -a GCF_011004845.1_fEsoLuc1.pri_genomic.fna.gz -p GCF_004354835.1_PFLA_1.0_protein.faa.gz -r GCF_004354835.1_PFLA_1.0_mRNA_from_genomic.fna.gz -b actinopterygii_odb9 -g ESOLUC.O+T+B+Helixer.gtf | bash > HANNO-ESOLUC-V0.4-trans+helixer.log 2>&1

Merging gene-models from protein (miniprot) and mRNA(minimap2) evidence improves recall and precision

A short glimpse how HANNO performs with protein only input compared to protein + corresponding mRNA input (using 25 vertebrate species from above)

image

Alignments of mRNAs strongly support recall of small terminal cds exons (start and stop codons next to or interrupted by splice sites), these are hard to find with protein alignment alone. This helping effect is limited by the divergence of the input dataset, as it is dependent on UTR alignability.

HANNO compared to other annotation pipelines and tools

The Gallus gallus dataset (proteins and transcriptomes, RefSeq annotation GCF_000002315.6_GRCg6a_genomic.gff for comparison) used in the Braker3 manuscript was used with HANNO. HANNO was tested with different evidences (P = protein, R = mRNA corresponding to P, T = transcriptome and combinations thereof). Braker1/2/3 (including GeneMarkET/EP/ETP and using A = ab initio predictions, P and T) were re-run for evaluation. A Helixer annotation was done on a Nvidia RTX6000 Ada GPU. The Braker3 ("braker.gtf") and GeneMarkETP ("genemark_supported.gtf") results were also piped through HANNO to accomodate for its gene selection by functional annotation. Values for Maker2 and Funnotate were taken directly from the publication. HANNO outperforms all methods in speed by a factor of at least 10-20X (same number of CPU threads, Intel(R) Xeon(R) CPU E7-8890 v4 @ 2.20GHz from 2017), while being in the top field of gene predictors regarding precision on the cds gene-level. Regarding annotation completeness, HANNO achieves the highest BUSCO scores and precision is inbetween GeneMarkETP and Braker3. It should be mentioned that HANNO produces respectable results on "same order mRNA-only" input (R), which no other method seems to be capable of. This makes HANNO promising for gene annotation with mRNA-like ISOseq data (to be tested).

image

Very recently, LiftOn, a tool similar to HANNO (both use combinations of minimap2 and miniprot), has been made available by the Salzberg lab (https://www.biorxiv.org/content/10.1101/2024.05.16.593026v1). Comparing both tools by transfering the Lagopus leucura RefSeq Annotation to Gallus gallus (divergence time ~36 MYA) showed highly similar results (the longest CDS model per gene were compared to the chicken reference annotation). Though both tools have their pro's and con's, HANNO is still faster and scales better with multi-threading. These test also show that the main computational bootleneck of HANNO is the functional annotation steps (BUSCO and eggNog) and not the gene-modelling.

image

Even more recently, Tiberius a new AI based annotation tool has been published (https://www.biorxiv.org/content/10.1101/2024.07.21.604459v1). It outperforms helixer in speed and precision (but does not annotate UTRs). It has been promoted as the “fastest state-of-the-art gene prediction method”. Tiberius, Hanno, LiftOn and Helixer were run on the human T2T genome. The two homology-based methods used the Callithrix jacchus RefSeq annotation (Homo/Callithrix div. time 43 MYA, corresponding to the minimal distance sequence data present the Tiberius training data). In contrast to the tests above a state-of-the-art HPC-server from 2023 was used. Tiberius and Helixer used an RTX 6000 Ada GPU, Hanno used up to 112 CPU threads. Speed limiting steps in Hanno (BUSCO/eggNog) were switched off, as the other methods do not perform such functional annotation steps. HANNO scaled well in the range of up to 20 threads in this scenario, higher thread values did only yielded minor speed improvements. Maximum RAM usage was 29GB (enabling annotation on modern laptops). At maximum speed HANNO annotated the Human genome in about 15 minutes, way faster than any other method. Further parallelization was checked also by running multiple human genome annotations in parallel at lower threads per HANNO job. This showed that HANNO is capable to annotate 8 - 9 human genomes per hour on contemporary HPC servers. All three methods, show similar precision, recall and BUSCO C: on the CDS gene-level (here we used all predicted isoforms for comparisons with the reference, to get the maximum values possible for HANNO and LiftOn, which are capable to predict isoforms).

INDEPENDENT TESTING BY COLLABORATORS

Martin Racoupeau and Christophe Klopp (INRAE, Toulouse, France) tested HANNO on a newly assembled Plant genome (245 Mbp, contig N50 22.25 Mbp) and compared results to Braker3 and Helixer. They used RNAseq data from the same species and protein data from related species. To make HANNO run on their cluster, they had to change "source path/to/activate" with "conda activate" in the bash script.

HISTORY AND ACKNOWLEDGEMENTS

This tool has been reaping in my mind over more than a decade and developed with every genome project I have been involved with. I thank all those colleagues who worked with me in those genome projects. Clara Daßio did a great job during her internship and wrote the bedDB to NCBI compatible GFF and GTF converter. I thank Martin Racoupeau and Christophe Klopp from INRAE, Toulouse for independent testing. Special thanks go out to Heng Li for his ground breaking work in bioinformatic tools. His MINIPROT tool has replaced SPALN2 in prior versions of HANNO and made the whole pipeline much more efficient and easy-to-use. Parts of this work were supported by my by DFG grant KU 3596/1-1; project number: 324050651).

About

FAST ANNOTATION PIPELINE FOR EUKARYOTES

Resources

Stars

5 stars

Watchers

2 watching

Forks

Releases

Packages

Contributors

Languages